PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca40239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 334aa    MW: 37186.3 Da    PI: 6.5779
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca40239.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.16.2e-082833162154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  Dca40239.1 283 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 316
                 469*****************************87 PP

2ELK29.22.1e-10237258122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++++++++E++
  Dca40239.1 237 ELKHELKQGYKEKIVDIREEIL 258
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.1E-1772116IPR005540KNOX1
PfamPF037902.0E-1673115IPR005540KNOX1
SMARTSM012567.5E-28125180IPR005541KNOX2
PfamPF037916.0E-20131179IPR005541KNOX2
SMARTSM011886.1E-4237258IPR005539ELK domain
PfamPF037897.4E-7237258IPR005539ELK domain
PROSITE profilePS512139.969237257IPR005539ELK domain
PROSITE profilePS5007111.742257320IPR001356Homeobox domain
SMARTSM003891.9E-11259324IPR001356Homeobox domain
SuperFamilySSF466892.48E-16259323IPR009057Homeodomain-like
CDDcd000861.29E-11260321No hitNo description
Gene3DG3DSA:1.10.10.601.2E-25264321IPR009057Homeodomain-like
PfamPF059207.1E-18277316IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSFHHNHHLQ DHHHQLTAQF SDHHHHHDGG GGGSNWLNMH SVDDTTAAAL TELTHRNSAA  60
AEDGVGEAAA AAALKAEILS HQLYEQLLSA HVSCLRIATP VDQLPRIDAQ LTQSHNVAAK  120
YSVIGGGGGG GDKELDQFMT HYVLLLCSFK DQLQQHVRVH AMEAVMACWE IEQSLQSLTG  180
VSPGEGTGAT MSDDEDDPVD SDSNVFDGSF DGHDTMGFGP LVPTESERSL MERVRQELKH  240
ELKQGYKEKI VDIREEILRK RRAGKLPGDT TSVLKAWWQS HSKWPYPTEE DKAKLVQETG  300
LQLKQINNWF INQRKRNWHS NPSGSTPAKS KRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12260323871Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313333RKRNWHSNPSGSTPAKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085237.11e-174PREDICTED: homeobox protein knotted-1-like 3 isoform X2
RefseqXP_015085236.11e-174PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotP480001e-168KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0K9R9E21e-176A0A0K9R9E2_SPIOL; Uncharacterized protein
STRINGGLYMA04G06810.11e-173(Glycine max)
STRINGPGSC0003DMT4000403511e-173(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-155KNOTTED1-like homeobox gene 3